Protein Info for GFF4079 in Variovorax sp. SCN45

Annotation: Cytochrome c4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 42 to 117 (76 residues), 24.7 bits, see alignment E=2.5e-09 amino acids 151 to 215 (65 residues), 23.2 bits, see alignment E=6.9e-09 PF00034: Cytochrom_C" amino acids 44 to 119 (76 residues), 40 bits, see alignment E=8.2e-14 amino acids 151 to 217 (67 residues), 34.4 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 44% identical to CYC4_THIRO: Cytochrome c4 from Thiocapsa roseopersicina

KEGG orthology group: None (inferred from 70% identity to vpe:Varpa_1217)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF4079 Cytochrome c4 (Variovorax sp. SCN45)
MKLFASLLLVALAGSFSGFSFAADPAAPGPTERAPAKLGKPDLANGEVVFNGKSCAACHS
ADGNSAIPANPKLAQQHPEYLVKQLQEFKSGKRKSPVMSGMAAMLSEQEMRNVAWFLGSK
AIKPGFAKDKDLVALGEKIYRGGIGDRNVPACAGCHSPNGAGIPIQYPRLGGQHAEYIAA
QLTAFRDGLRLNSVPMSGVAAKLNDREIKAVSDFIAGLH