Protein Info for GFF4077 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 136 (133 residues), 149.8 bits, see alignment E=1.6e-47 amino acids 146 to 243 (98 residues), 110 bits, see alignment E=2.1e-35 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 259 (256 residues), 356 bits, see alignment E=1.3e-110 PF00460: Flg_bb_rod" amino acids 9 to 35 (27 residues), 35 bits, see alignment (E = 1.7e-12) PF22692: LlgE_F_G_D1" amino acids 96 to 159 (64 residues), 83.7 bits, see alignment E=1.2e-27 PF06429: Flg_bbr_C" amino acids 215 to 259 (45 residues), 75.2 bits, see alignment 3.4e-25

Best Hits

Swiss-Prot: 50% identical to FLGG_BUCAP: Flagellar basal-body rod protein FlgG (flgG) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 72% identity to bpd:BURPS668_A0242)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF4077 Flagellar basal-body rod protein FlgG (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNPAMWVSKTGVQAQDAKLQAIANNLANVNTVGFKRDRVMFEDLFYQVERQPGTARDENT
NTPTGVQLGNGTRVVGTQKVFTTGSLQTTGQQLDVAIVGQGFLQVELANGDTAYTRAGQL
QTSPEGRLVTAQGYPIVPDITVPANALSIAIGENGVVSAKIAGETELTELGQITLAGFVN
PAGLVALGDNLFQETAASGVPNEGVPGEEAFGKLKQGALEGSNVQVVEEMVEMISAQRTY
EMNTKVLSAADGMLQNLAQAVR