Protein Info for GFF4067 in Variovorax sp. SCN45

Annotation: FIG00897050: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 382 to 402 (21 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details PF02661: Fic" amino acids 404 to 474 (71 residues), 45.8 bits, see alignment E=4.7e-16

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_1002)

Predicted SEED Role

"FIG00897050: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>GFF4067 FIG00897050: hypothetical protein (Variovorax sp. SCN45)
MATHPTSVSRKATPAQRRLATALEALHVLQAQGHGVFNTSQFSRTDREALLAARYLQPVI
QGWYMSASPSAKAGDTTPWIAGMKDFIAAYCNARFGADWCVSAEYSLKLHAGTTLLPQQV
VIHSPLGKNGVLDLPNGFSLMDYQARDFPGPDRRDSVGNIRTMTLAQALLKAPENFFRAS
AQDAQVALLSISDASELSRLLAEGNHSTIAGRLAGAFRAVGRGAISDDILGFMRALGNQV
TEFNPFEIPPRIVPGDRIESPYVSRLRLMWASMRDDVMGDFPQQEPGSPGDVDAFMQAVE
DVYVTDAYHSLSIEGYRVTPELIRRVAGGDWNEDIHEQDRQSRDAMAAHGYWLAHNEVKV
SIRKIFSGAIAGDVLKGDHGAWFRAMFAPSVTAGLLAATDLAGYRGHQVYIRNAQHVPPP
REAVREMMPVLFELLRDERSAAVRAVLGHFMFVFIHPYMDGNGRLGRFIMNTMLASGGFP
WTVLRLEDRDRYMAALNAASGQGDIKPFASFVAQSLDAARDAQADPLHDDGALEANIEED
DPQRPRG