Protein Info for PS417_20835 in Pseudomonas simiae WCS417

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 215 to 234 (20 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 62 (60 residues), 63.3 bits, see alignment E=1.6e-21 PF03466: LysR_substrate" amino acids 88 to 286 (199 residues), 152.8 bits, see alignment E=8.7e-49

Best Hits

Swiss-Prot: 37% identical to YUST_BACSU: Uncharacterized HTH-type transcriptional regulator YusT (yusT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU4582)

Predicted SEED Role

"Transcriptional regulators, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U071 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PS417_20835 LysR family transcriptional regulator (Pseudomonas simiae WCS417)
MELAQLKMVRAVAQTGSVAQAAVQLHCVPSNITTRIKQLESELGTPLFIRAGRGLAISAA
GEIFLEYCERILALVDESKRAVDANAIPRGTLRIGAVESSASGRLPPLLAEYHRRYPDVS
LELVTGAWGELLDDLQHHRLDVALVAAGNKRAKLEHSVVYSERLVLIASASSEPIRSAED
LAGRTLLVWPPGCPYRAALENWVKPHAFKPAIASYASWGTIIGCVSAGIGVALAPEGILA
RYEQANQLASYRFEELQAVENLLFWHKDTQRHLARDAFAGLLRETFG