Protein Info for GFF4066 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar motor rotation protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 282 (282 residues), 332.5 bits, see alignment E=9.2e-104 PF20560: MotA_N" amino acids 4 to 89 (86 residues), 86.3 bits, see alignment E=1.4e-28 PF01618: MotA_ExbB" amino acids 134 to 240 (107 residues), 56.4 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 52% identical to LAFT_VIBPA: Chemotaxis protein LafT (lafT) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 73% identity to cvi:CV_2989)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF4066 Flagellar motor rotation protein MotA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQLFVGALVILLTVFGGFLLGGGDLAVVWEPVELLIIGGAGLGAIIVGNPRHVLSEMGIQ
LRKLVGSRKEGEEFQRQLLLLMYELLQTAAGGIKALDAHVEEPHKSAIFLKYPLVLDEPK
LLHFIVDNFRLMAIGKINAHELEGVLEQELEAIHEELNQPAKSLHKIGEAMPGFGILAAV
LGIVMAMNSVAAGASAGEIAAKVAAAMVGTFIGIFMCYAVLDPISNMMKQLVKEEMSHME
AVKVVLVTHVSGKVALLAIDAGRRLVQLNIKPSFSKLESWINALEGREEEPKQEFNRRAG
DRRVQA