Protein Info for GFF4065 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: RNA polymerase sigma factor for flagellar operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 29 to 236 (208 residues), 104.6 bits, see alignment E=4.2e-34 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 31 to 238 (208 residues), 229.1 bits, see alignment E=5.5e-72 PF04542: Sigma70_r2" amino acids 33 to 100 (68 residues), 45.6 bits, see alignment E=1e-15 PF04539: Sigma70_r3" amino acids 110 to 159 (50 residues), 30.1 bits, see alignment 8.8e-11 PF08281: Sigma70_r4_2" amino acids 182 to 221 (40 residues), 35.5 bits, see alignment 1.3e-12 PF04545: Sigma70_r4" amino acids 187 to 235 (49 residues), 60.2 bits, see alignment 2.3e-20

Best Hits

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 60% identity to bpd:BURPS668_A0233)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>GFF4065 RNA polymerase sigma factor for flagellar operon (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSDGMYGGYTEMASVAAAELGAADEQRHLLAFTPLVRRTVRQLSSQVGGAMDRDDMMQIG
LMGLLEALRRYGEPDERFPAFAGLRVRGAILDELRRQDWRPRSVRQESFRLKAEVRALTK
RLGREPTEAEVLAELDISPEAYLAYQQDSNAETLASFDDLFDTLSNEASSQRSPEAELVL
KRSLQQALGTLSEREQRVIQLYYEYELSLKEIAAVLGLTEARICQINKAALQKMKTVLQT
D