Protein Info for GFF4065 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane protein ImpK/VasF, OmpA/MotB domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 244 to 263 (20 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 62 to 271 (210 residues), 218.4 bits, see alignment E=9.5e-69 PF09850: DotU" amino acids 63 to 265 (203 residues), 202.4 bits, see alignment E=6.5e-64 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 296 to 432 (137 residues), 162.8 bits, see alignment E=4.4e-52 PF00691: OmpA" amino acids 328 to 426 (99 residues), 57.7 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 100% identity to stt:t2581)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF4065 Outer membrane protein ImpK/VasF, OmpA/MotB domain (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAA
ANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRY
CLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEV
IYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVMPALSPDFQGAISGRLRRM
RRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAIGIKLPPPPVPVHKLRLKIL
LANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAAREIARVGGAVTV
TGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE