Protein Info for GFF4061 in Sphingobium sp. HT1-2

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR02392: alternative sigma factor RpoH" amino acids 18 to 288 (271 residues), 361.7 bits, see alignment E=2.9e-112 PF00140: Sigma70_r1_2" amino acids 18 to 47 (30 residues), 41.5 bits, see alignment (E = 1.6e-14) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 51 to 287 (237 residues), 111.1 bits, see alignment E=4.4e-36 PF04542: Sigma70_r2" amino acids 56 to 124 (69 residues), 60.7 bits, see alignment E=1.4e-20 PF04545: Sigma70_r4" amino acids 234 to 285 (52 residues), 58.6 bits, see alignment 5.3e-20

Best Hits

Swiss-Prot: 77% identical to RPOH_ZYMMO: RNA polymerase sigma factor RpoH (rpoH) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 90% identity to sjp:SJA_C1-19420)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF4061 RNA polymerase sigma factor RpoH (Sphingobium sp. HT1-2)
MANRSNVPAVPALGGEASLNRYLSEIRKFPLLTPEQEYMLAKRYEEHQDPEAAAQLVTSH
LRLVAKIAMGYRGYGLPVSELISEGNIGLMQGVKKFEAERGFRLATYAMWWIRASIQEFI
LRSWSLVKMGTTASQKKLFFNLRRMKNNIEAFEDGDLRPEDVTKIATDLGVSEDDVVSMN
RRMAMGGDTSLNVPMREDGDGQWQDWLQDTDPLQDERVAEEQERTQRHEMLVEAMTDLND
REKHILAERRLAEEPKTLEELSQVYGVSRERVRQIEVRAFEKLQKAMMRIAGGKLEKMAR
FAAA