Protein Info for GFF4057 in Variovorax sp. SCN45

Annotation: Copper/silver efflux RND transporter, membrane fusion protein CusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 143 to 437 (295 residues), 139.3 bits, see alignment E=7.1e-45 PF16576: HlyD_D23" amino acids 153 to 364 (212 residues), 260.7 bits, see alignment E=3e-81 PF16572: HlyD_D4" amino acids 199 to 254 (56 residues), 70.7 bits, see alignment 2.6e-23 PF13437: HlyD_3" amino acids 260 to 361 (102 residues), 67 bits, see alignment E=8e-22 PF11604: CusF_Ec" amino acids 480 to 545 (66 residues), 57.4 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 73% identity to dac:Daci_0474)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>GFF4057 Copper/silver efflux RND transporter, membrane fusion protein CusB (Variovorax sp. SCN45)
MKTRPLVLGLIAAAVLAAAAVGAYTFGVQRGRSLGSSSATSGGTSSMATPSASTTAAPAA
SPNETGEDATRRHIAAGLKAGDTDPNNGKKILYYHDPMVPGNRFDKPAKSPFMDMMMSPV
YAGGDGDQNSVTVSARVQQNLGVRTAVVSEGTVSPQVTTVGSIAFNERDQVIVQARATGY
VERLNVRATLDQVKKGQPLAELYVPEWIAAQEEFLSVQRMRGTDLASLIDGARQRMRQVG
MNDGQIELVARSGRTQPRITLVAPIGGVVTELAAREGMTVSAGTTLFRINGLASVWANAE
VPESQSALVRLGARVQARTPAAPGETFEGKVQAILPDVNPATRTLKARLELANPTGRLVP
GMFVSMQFTDMRADKTLLIPTEAVIQTGKRAVVMLAEDNGRFRPVDVEIGLETGGQTEIK
RGLQAGQRVVVSSQFLIDSEASLKGVEARLNAAPGTAAPTAATAASATPAAGAPRHVGEG
KVESITKDAMTFSHGPIPTIKWGAMTMEFKLPPGGTPGNLKPGDRASFEFFIDADDLPQL
TRVTPMATAPAASAAATPKAAAPGSKP