Protein Info for GFF4055 in Sphingobium sp. HT1-2

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 10 to 407 (398 residues), 662.4 bits, see alignment E=1.4e-203 PF06689: zf-C4_ClpX" amino acids 14 to 50 (37 residues), 72.7 bits, see alignment 7.2e-24 PF05496: RuvB_N" amino acids 73 to 194 (122 residues), 27.3 bits, see alignment E=1.1e-09 PF07724: AAA_2" amino acids 112 to 309 (198 residues), 122.5 bits, see alignment E=7.4e-39 PF07728: AAA_5" amino acids 114 to 192 (79 residues), 24.8 bits, see alignment E=8e-09 PF00004: AAA" amino acids 115 to 242 (128 residues), 64.5 bits, see alignment E=5.5e-21 PF10431: ClpB_D2-small" amino acids 319 to 387 (69 residues), 43.2 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 87% identical to CLPX_SPHWW: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 99% identity to sjp:SJA_C1-19450)

MetaCyc: 70% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF4055 ATP-dependent Clp protease ATP-binding subunit ClpX (Sphingobium sp. HT1-2)
MTKLTGSDSKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCNDIIREETKGGLVGKK
DGGVPTPQEICDVLDDYVIGQKRAKRVLSVAVHNHYKRLNHGSKPGEVELAKSNILLVGP
TGCGKTLLAQTLAKTFDVPFTMADATTLTEAGYVGEDVENIILKLLQASDYNVEKAQRGI
VYIDEIDKISRKAENPSITRDVSGEGVQQALLKLMEGTTASVPPQGGRKHPQQEFLQVDT
TNILFICGGAFAGLEKIIGDRLEAKSIGFGAHVAAPEERKTGELLRQSEPEDLLKFGLIP
EFVGRLPVIATLEDLDVTALVKILVEPKNALVKQYGKLFDMENVELSFTDDALTAIAKKA
IERKTGARGLRSILEAILLDTMFDLPSMEGVGEVVVDKDVVAGTKEPIRVFSEKDKRAED
AA