Protein Info for GFF4055 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 32 to 449 (418 residues), 165.3 bits, see alignment E=1.4e-52 PF01514: YscJ_FliF" amino acids 51 to 226 (176 residues), 176.4 bits, see alignment E=5.4e-56 PF08345: YscJ_FliF_C" amino acids 260 to 414 (155 residues), 112.1 bits, see alignment E=3.2e-36

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 42% identity to pmy:Pmen_4417)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>GFF4055 Flagellar M-ring protein FliF (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNALRLMRDKLPLGKALGGAWRPELASRLLPVVLLAIGITAMVMMFLWNDQASYKPVFGA
REQVPVSDMMATLDAEGIGYRLHPETGQVLVSSSDLGRVRMLLAAKGVTARLPEGLELMD
KNDPLGVTQFVQDIRFRRGLEGELVQSITSMDAVRSARVHLSVARSSTFVLNAQDKSTAS
VVLNLHPGRTLGNEQIASIIQLVAGSVSNLDPSRVSVVDQAGRLLSARVDVKDGIDNGSF
ADEAARKAQNDILQNAHQLLQPLLGAGNYNVSVAVELGQDRVQETQERYGDSPKVTNEAS
REESNRDRVALGVPGSLSNRPATPAPDANAAPNTAERSAVTRQFAYDRSVTTIQRARGQL
KKLSVAVVLNEGAAPGGAASWGPQEIARMESLLRGGLGINAERGDQLVVSALAFPGAAPA
VPWYAERETVFEFVTWGLYALGALLAYLLLARPLLRLLRERNKPAAEIGMTDLIALEGGP
GNAEEAPALAQPSPAVAALPNKVQPSTSGAMVPLLADYDLPPPGSPVEVLVNHLKVLAQK
EPERVAEVVKQWVQKNAAIT