Protein Info for GFF4054 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ClpB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 18 to 865 (848 residues), 1256.1 bits, see alignment E=0 PF00004: AAA" amino acids 236 to 367 (132 residues), 37.7 bits, see alignment E=1.2e-12 amino acids 615 to 711 (97 residues), 29.4 bits, see alignment E=4.4e-10 PF17871: AAA_lid_9" amino acids 379 to 471 (93 residues), 100 bits, see alignment E=3e-32 PF07724: AAA_2" amino acids 609 to 776 (168 residues), 180.7 bits, see alignment E=1.1e-56 PF07728: AAA_5" amino acids 614 to 733 (120 residues), 33.8 bits, see alignment E=1.4e-11 PF10431: ClpB_D2-small" amino acids 783 to 856 (74 residues), 46.3 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to stm:STM0272)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (879 amino acids)

>GFF4054 ClpB protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRH
YQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLL
ALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESS
QAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRTMTDILLRRRQNNPLLTGE
AGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAGASMKGEFESRLKGLLEEAG
RSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWSEYKRHIEKDP
ALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALM
ARIFSLNNELTASESRWQRELELVHTLQELRLAESDADDKTTLQQAETALREWQGDAPVV
FPEVSAAVVAAIVADWTGIPAGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTA
RAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAIYGGEQNLVTINMSEFQEAHTVSTLK
GAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHV
DFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYL
PLDETSRGVIARLHLDRLVARMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC