Protein Info for GFF4047 in Variovorax sp. SCN45

Annotation: Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein CzcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details PF25971: CzcB_N" amino acids 93 to 184 (92 residues), 110.8 bits, see alignment E=6.6e-36 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 213 to 514 (302 residues), 165.7 bits, see alignment E=6.4e-53 PF25973: BSH_CzcB" amino acids 231 to 374 (144 residues), 108.7 bits, see alignment E=2.8e-35 PF25893: HH_CzcB" amino acids 270 to 328 (59 residues), 91 bits, see alignment 9.5e-30 PF25954: Beta-barrel_RND_2" amino acids 377 to 451 (75 residues), 54.2 bits, see alignment E=3.5e-18 PF25975: CzcB_C" amino acids 459 to 519 (61 residues), 95 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 52% identical to CZCB_CUPMC: Cobalt-zinc-cadmium resistance protein CzcB (czcB) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 58% identity to ajs:Ajs_1848)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>GFF4047 Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein CzcB (Variovorax sp. SCN45)
MANSWQSTLGKPGRKQLFIIIFLLIVGAAAGALILRGGSSKKAVEGGGHAEETAKGEDGH
GHGKSAEDDGHGHGKSEEGGHEEASAPKGPNGGQRFTEGDFSIELKLAEENGEPRFKAWL
YDKEKPIAPTDAEVTVTLNRPNGDQQEVKLAPVAGVLTSQQTVAEPHIFEATIAVQTPKE
PYLFTFNQQEGKVNMTDAQIKASSITLDTSAPESIRSGLQFPGEIRFNEDRTAHIVPRVA
GVVDSVSANLGERVKKGQVLAVVSSAAISETRSELQAAQRRRELAKTTYDREKSLWEQKI
SPEQDVLQAQQALREAEISVANATQKLLTVGASTSSSSLGRFELRAPFDGMVVEKHIALG
ESVKEDASVFTISDLSNVWAEMNVPARDLQQVRVGERVVVRSGAFDATTNGTVAYVGSLI
GEQTRTARARVVLPNPQGAWRPGLFVSVEVLASEVISPVTVASSALQTIEDKPVVFLKVP
GGFVPQPVQIGRTDGKRVEIVSGLKAGAKYAAAGSFVVKSEQGKGSATHTH