Protein Info for GFF4040 in Xanthobacter sp. DMC5

Annotation: Non-heme chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00561: Abhydrolase_1" amino acids 24 to 261 (238 residues), 110.9 bits, see alignment E=1.6e-35 PF12146: Hydrolase_4" amino acids 25 to 126 (102 residues), 50.7 bits, see alignment E=3.1e-17 amino acids 211 to 261 (51 residues), 27.1 bits, see alignment 4.9e-10 PF12697: Abhydrolase_6" amino acids 25 to 244 (220 residues), 65.5 bits, see alignment E=2.2e-21 PF00326: Peptidase_S9" amino acids 159 to 259 (101 residues), 25.3 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 81% identical to PRXC_BURPY: Non-heme chloroperoxidase (cpo) from Burkholderia pyrrocinia

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 84% identity to azc:AZC_1383)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF4040 Non-heme chloroperoxidase (Xanthobacter sp. DMC5)
MAYVTTKDGVDIFYKDWGPKDAQPIVFHHGWPLSSDDWDAQILFFLQHGFRVVAHDRRGH
GRSAQVSEGHDMDHYAADAAAVMEHLDLRNAVHIGHSTGGGEVARYVARHGQPQGRVAKA
VLVSAVPPLMVKTAANPGGTPLEVFDGFRSALAANRSQFFMDVASGPFYGFNLPGTTPVP
GVIQNWWRQGMTGGAKAHYDGIKAFSETDQTEDLKLITVPTLVMHGDADQVVPIDDAARL
SVKLLKNGTLKVYAGYPHGMLTVHADVINPDLLAFVKA