Protein Info for GFF4039 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LysR family transcriptional regulator YafC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00126: HTH_1" amino acids 7 to 64 (58 residues), 79 bits, see alignment E=2e-26 PF03466: LysR_substrate" amino acids 89 to 292 (204 residues), 150 bits, see alignment E=6.4e-48

Best Hits

Swiss-Prot: 90% identical to YAFC_ECOLI: Uncharacterized HTH-type transcriptional regulator YafC (yafC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sek:SSPA2344)

Predicted SEED Role

"LysR family transcriptional regulator YafC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF4039 LysR family transcriptional regulator YafC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKLGVSLLNRTTRQLSLT
EEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVMLHFLMPLIKPFRERYP
EITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSYRKIIASPDYIARFGKPE
TVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGISSNSGETLKQLCLNGNGIACLS
DYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDRAVSTRIRAFIDFLSEYIRTAPAGA
VKEG