Protein Info for GFF4038 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type uncharacterized transport system, fused permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 860 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details amino acids 462 to 483 (22 residues), see Phobius details amino acids 513 to 537 (25 residues), see Phobius details amino acids 549 to 629 (81 residues), see Phobius details amino acids 642 to 664 (23 residues), see Phobius details amino acids 672 to 694 (23 residues), see Phobius details amino acids 700 to 719 (20 residues), see Phobius details amino acids 830 to 847 (18 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 33 to 724 (692 residues), 718.5 bits, see alignment E=4.2e-220 PF06808: DctM" amino acids 136 to 666 (531 residues), 229.2 bits, see alignment E=8.3e-72 PF11874: DUF3394" amino acids 677 to 851 (175 residues), 200.1 bits, see alignment E=2.4e-63

Best Hits

KEGG orthology group: None (inferred from 60% identity to teq:TEQUI_1465)

Predicted SEED Role

"TRAP-type uncharacterized transport system, fused permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (860 amino acids)

>GFF4038 TRAP-type uncharacterized transport system, fused permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTDIEKAPEALQQLVADSDTGGRKPTGVTAGVVFSVCLLWALFQYWYASPLPFELGIGI
LNDTEARAIHLAFALFLAFLAWPAFKRSPRHRVPVIDWLLAGVAAFCGAYIMLFYADLAT
RPGQPNGLDIAVGFAGVVLLLEATRRAVGWPMAALAVVFLAYCLLGPHLPEVLSHKGASV
NRLISHMWLTTEGVYGIALGVSAGTIFVYVLFGALLDRAGGGNYMMQVSFAALGHLRGGP
AKVAVVSSALNGMISGSSVSNVVSGGIFTIPLMKKAGYGGVKAGAIETMSSVNGQIMPPV
MGAAAFLMVEYVGIPYADIVKHAFLPATLSYIGLLYIVHLEALKLGMQPIVQAVARPWRV
RLLRNAIGIAGSIAVVCSVYYLLQGIKAVMGPVAPYAASAVVLGLYLFSVYQAAGCPDLP
DDIDIDHPRPLQTWPTVRAGLHYLMPIAVLIWCLMVEEMSPALSAFWAVTVLIVLMLTQR
PLIALFRRTSGAGTWLQGWRSVVDGFNDGSRNMIGIGVATATAGIIVGAITLTGLGLRMT
EFVEFVAQGNVMMMLLFIAFVCLVLGLGVPTTANYVLVATLMAPVVVELGAQSGLIIPLV
AVHLFVFYYGIMGDITPPVGLATFAAAAISGEDAIQTGVQGAIYALRTVILPFIWIFNPQ
LLLINVHSTPELIRLLLACTLATLLFAAATMNWFRVKSRWWETVLLLLAVLLLFRPDFFM
DRLAPEYREVPASQVYEVARDTPADDRVVMIIQGTTIEGDDVVKTVALQLGEKGEDGRKR
LSEAGLQLVPLGAAVQIGQVKFGTRAAKSGFEQGWDVTGVQVPSGRATPHWFYLPALLLV
ALVWWSQGRRMAAPRTLKVA