Protein Info for PS417_20680 in Pseudomonas simiae WCS417

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF00892: EamA" amino acids 17 to 140 (124 residues), 38.4 bits, see alignment E=6.9e-14 amino acids 152 to 283 (132 residues), 49.3 bits, see alignment E=2.9e-17

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_1416)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFR1 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PS417_20680 multidrug DMT transporter permease (Pseudomonas simiae WCS417)
MSVLSKQSVAAAASTSLFVLLWSSGAIFSKWGLAHASPFAFLLIRFAIALAGLMVLIPIL
KLKLPRPGKPLLYAAATGLVLLGAYQIFYLLALNLSVTPGVMATIMGVQPILTVVLMERQ
RSLSRMFGLTLGLAGLIMVVYQGIGLSGMSLAGMLFGLLALASMTFGSIMQKRITDNPLG
TLPVQYLAGLLLCSVFVPFQPFHFEYSSSFYLPVLWMGLVVSLLATLLLYRLIARGNLVN
VTSLFYLVPAVTAVMDYLIFGNRLAMLSVLGMGLIIVGLVFVFRKG