Protein Info for GFF4037 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP transporter solute receptor, TAXI family precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 10 to 322 (313 residues), 334.5 bits, see alignment E=2.5e-104 PF16868: NMT1_3" amino acids 33 to 322 (290 residues), 299.3 bits, see alignment E=3.8e-93 PF09084: NMT1" amino acids 113 to 197 (85 residues), 28.4 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 86% identity to pol:Bpro_2004)

Predicted SEED Role

"TRAP transporter solute receptor, TAXI family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF4037 TRAP transporter solute receptor, TAXI family precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKIPLSLSTLATAAALMTPMAPAQAQQKFMTIGTGGVTGVYYAAGGAICRLVNKDRARH
GIRCSVESTGGSVFNVNTIKAGELDLGFTQSDVQFNALKGVGQFKDAGAYGDLRAVFAVH
PEPFTVVARKEANITKFEDFKGKRFNVGNPGSGTRSSMEELLAGMGWKLSDFSLASELKA
DEHGPALCDGKIDGFYYAVGHPSANIQDPTTSCGAKLVSITGPAVDKLVAEKPYYAKVTL
PGGLYPNNPQPTQTYGVSATVVASSKTSAETVYQVVKAVFDNFDEFKKLHPALANLTPEG
MVKDGLSAPLHEGALKFYKEKGWVK