Protein Info for GFF4034 in Variovorax sp. SCN45

Annotation: Cobalt/zinc/cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 1 to 260 (260 residues), 278 bits, see alignment E=4.1e-87 PF01545: Cation_efflux" amino acids 1 to 181 (181 residues), 143.9 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 66% identity to har:HEAR1602)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF4034 Cobalt/zinc/cadmium resistance protein CzcD (Variovorax sp. SCN45)
MVAEVIGGLVTGSLALISDAAHMFTDTAALAISLAAIQIGKRAVDAKRTFGYYRFEILAA
AFNALLLFGVAIYILYEAWQRMRSPQTVDSIPMLIIAALGLVVNLVSMRLLSSGKDRSLN
VKGAYLEVWSDMLGSMGVIAGAVVIWFTGWTWVDSVIAVAIGFWVLPRTWLLLRDSMNIL
LEGAPDDVDVAEIEKALRELPSVDSIHELHVWAISSGKVSLSVHLVSGSGDLDSLVAEGS
RILAERFDIHHSTIQPERVPCGQASETHRFE