Protein Info for GFF4032 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable Co/Zn/Cd efflux system membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 32 to 358 (327 residues), 219.6 bits, see alignment E=2.5e-69 PF25954: Beta-barrel_RND_2" amino acids 204 to 280 (77 residues), 30.6 bits, see alignment E=6.6e-11 PF25967: RND-MFP_C" amino acids 290 to 347 (58 residues), 30.2 bits, see alignment E=7.2e-11 PF25975: CzcB_C" amino acids 293 to 351 (59 residues), 28.3 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: None (inferred from 60% identity to aav:Aave_1462)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF4032 Probable Co/Zn/Cd efflux system membrane fusion protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTPHFVLIVTAALALSACSRPPAPEEPIRSVKLLTVGTGNVVARSEYAGEVRARTESRL
GFRVGGKLVARPAEVGQRVKPGQLLAQLDAQDLALSSQAAQAQVSAAQTQRDLAAADLKR
YQDLQAQGFVSGAEIERRQATLQSAEATLRQAKAQGAVQGNQAGYARLLADGDGVVLSVE
AEVGQVVAAGTPVVRVARDGARDVVIAVPEDRVAQIRPGATAQVRLWAGAGAASAAAAPL
EATVREVAASADAATRTYQVKLSLPDGAAVPLGATAYVTLGGAVAGPAVIKLPTSALMRA
DQGSAVWVFDAAAGTVQPRPVKVAGADGNEMVILDGLKPGEEVVATGVHVLSPGQKVTRF
TASATQ