Protein Info for GFF4030 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 76.2 bits, see alignment E=2.6e-25 TIGR02047: Cd(II)/Pb(II)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 155.9 bits, see alignment E=2.6e-50 PF00376: MerR" amino acids 2 to 39 (38 residues), 50 bits, see alignment E=3.2e-17 PF09278: MerR-DNA-bind" amino acids 44 to 107 (64 residues), 66 bits, see alignment E=5.8e-22

Best Hits

Swiss-Prot: 48% identical to ZNTR_HAEIN: HTH-type transcriptional regulator ZntR homolog (zntR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 80% identity to ctt:CtCNB1_2463)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>GFF4030 Transcriptional regulator, MerR family (Variovorax sp. SCN45)
MKIGELASATGMQIPTIRFYEQEALLSPPARTAGNYRRYDESHVQRLAFVRHCRSLDMSL
EDIRVLLKFKDHQNEPCDEVNELLDKHILQLAKRIEELRSLEGLLMTLRAQCCSGQVAER
CGILDGLTAASQKQ