Protein Info for GFF403 in Xanthobacter sp. DMC5

Annotation: Membrane-bound lytic murein transglycosylase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01464: SLT" amino acids 610 to 711 (102 residues), 86.5 bits, see alignment E=1e-28 PF27553: SLT_superhelical" amino acids 726 to 750 (25 residues), 31.9 bits, see alignment (E = 9.2e-12)

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 81% identity to xau:Xaut_3828)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (765 amino acids)

>GFF403 Membrane-bound lytic murein transglycosylase C (Xanthobacter sp. DMC5)
MSPVSSLMSVSALALALAWSGAMPAAAESAPTPPAKPSASASKDSKSTDAKSKDAKSKDS
KTADSKSKDAKAKDTKAKDSKSSTPAKPAAAAKPAASKSATTKPAAGKPAAARVAPTVHQ
PAPTVGASSSIPGGDLAALKVAVTAARNGRAAEAMGAAQQLDDPVARTLVTWLVIRHAPN
DLGFNAINEFIQEKPGWPTQSTLRRRAERVLFQENKDPAKAQAFFADQAPLSGEGKVALA
RYLVSIGKRQDAAEWVRDAWRNDELNELFESKIIDEFSGFLTRADHKLRADHFSYKPDTD
RALRAAARAGSDIVALTKARMAIARKEANGEKLLGLVPFTLSSDPAYLFAKSQLLRRADK
PQEAARALLAGSSSDQVLADPDEWWIERRLVARELLDAGDFQTAYKVAATGVPPQADNYR
AEQQWTAGWIALRFLKDPSRAAQHFAKVDDDQKHPITLSRAYYWQARAAEAMGDRGRANA
AYQAAAKFSATYYGQLSRTKLGMAPVVLRGAPSPSFGARDTFARLEPVKAIRMLYAVGAR
DIPLTIYYDLAWRMEDSSQLAMLATLAESNNDPRGALVVGKEGLAEGHPLEAEAFPTFGL
PNYSPIGDPVDKAAVYAIARQESQFNPAIVSSAKAMGLMQVTPEAGRQVAKITGVAYDER
RLMSDQSYNVQFGAAELGELVAQYGGNYVLAFAAYNAGRGSVAKWIARYGDPRDPDVDVV
DWVECIPFSETRNYVQRVMENYQVYKVRFNIPSKLQMEADLRGGR