Protein Info for PS417_20620 in Pseudomonas simiae WCS417

Annotation: glycosyl transferase family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 242 to 269 (28 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 10 to 173 (164 residues), 64.8 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: None (inferred from 71% identity to pfl:PFL_5488)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPX5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PS417_20620 glycosyl transferase family 2 (Pseudomonas simiae WCS417)
MSDQTTKIAVLIPSYKVKSHILEVIRLIGPEVCKIYVVDDCCPDGSGDFVIQHCTDERVI
VLRNPVNLGVGGAVMTGYRTAIADGIDIIVKIDGDGQMDPSLISDFVSPIIAGNADYTKG
NRFFNLEKISEMPKIRLFGNAVLSFMTKLSSGYWELFDPTNGYTAIHSEVAKHLPLDKIS
QRYFFETDMLFRLNTLGAVVIDIPMDAKYEDEVSNLKVSKVIGEFLIKHIRNFGKRIFYN
YYLRGMSLASIELPFGLILLTAGSTFGISHWIESLQQNVPTPAGTVMLSALPVIIGFQLL
LAFIGHDISSSPRRAFHVLRKKHILPKRDQRS