Protein Info for GFF4022 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methyltransferase type 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF02353: CMAS" amino acids 18 to 93 (76 residues), 31.1 bits, see alignment E=6.1e-11 PF13489: Methyltransf_23" amino acids 29 to 197 (169 residues), 50.3 bits, see alignment E=9.2e-17 PF01135: PCMT" amino acids 33 to 150 (118 residues), 36.6 bits, see alignment E=1.7e-12 PF01209: Ubie_methyltran" amino acids 38 to 146 (109 residues), 73.1 bits, see alignment E=9.4e-24 PF13847: Methyltransf_31" amino acids 44 to 146 (103 residues), 71.7 bits, see alignment E=2.3e-23 PF13649: Methyltransf_25" amino acids 48 to 144 (97 residues), 85.4 bits, see alignment E=1.5e-27 PF08241: Methyltransf_11" amino acids 49 to 146 (98 residues), 81.7 bits, see alignment E=2e-26 PF08242: Methyltransf_12" amino acids 49 to 146 (98 residues), 57.9 bits, see alignment E=5.8e-19

Best Hits

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 52% identity to sus:Acid_5193)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF4022 Methyltransferase type 11 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDARLQRRVQRYGWDLAADDYETLWQAQLAPAQARLLEKVALQAGEHVLDVACGTGLVTL
RAAQGVGPLGQVIGVDLSERMVQAAARRAHAGGQPHLRFERMDAEQLALPDAGLDAALCA
FGLMYLPEPEQALKELLRVLRPGGRLGLAVWGERERCGWSALFPIVDAEVTTEVCPLFFR
LGQGDTLARLCGEAGATGLQTERLSTTLRYASGDEACRAAFAGGPVALAWSRFGDAARAR
ACARYLDALAPWRRGAGHAVPAEFVLVTGRKPERT