Protein Info for GFF4017 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR00207: flagellar motor switch protein FliG" amino acids 1 to 331 (331 residues), 499.1 bits, see alignment E=3.5e-154 PF14842: FliG_N" amino acids 3 to 103 (101 residues), 102.5 bits, see alignment E=3.7e-33 PF14841: FliG_M" amino acids 115 to 187 (73 residues), 86.3 bits, see alignment E=2.7e-28 PF01706: FliG_C" amino acids 218 to 323 (106 residues), 129 bits, see alignment E=1.9e-41

Best Hits

Swiss-Prot: 100% identical to FLIG_SALTI: Flagellar motor switch protein FliG (fliG) from Salmonella typhi

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to ses:SARI_00967)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF4017 Flagellar motor switch protein FliG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSNLSGTDKSVILLMTIGEDRAAEVFKHLSTREVQALSTAMANVRQISNKQLTDVLSEFE
QEAEQFAALNINANEYLRSVLVKALGEERASSLLEDILETRDTTSGIETLNFMEPQSAAD
LIRDEHPQIIATILVHLKRSQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLN
GLLDGQNLKRSKMGGVRTAAEIINLMKTQQEEAVITAVREFDGELAQKIIDEMFLFENLV
DVDDRSIQRLLQEVDSESLLIALKGAEPPLREKFLRNMSQRAADILRDDLANRGPVRLSQ
VENEQKAILLIVRRLAETGEMVIGSGEDTYV