Protein Info for GFF4012 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Two-component hybrid sensor and regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details PF00512: HisKA" amino acids 223 to 287 (65 residues), 56.4 bits, see alignment E=3.7e-19 PF02518: HATPase_c" amino acids 333 to 446 (114 residues), 82.3 bits, see alignment E=5.2e-27 PF00072: Response_reg" amino acids 474 to 583 (110 residues), 63.4 bits, see alignment E=3.2e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>GFF4012 Two-component hybrid sensor and regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
VTGMPSSNLRMAVQRTRLELLLQKTGPLRILSPIPFATPLAILFVLDGASRLPLVWLGLF
YLVVFVSYVQRRKLETHGPLQDHELSHVLRGRIRDILLLGTLWGAAPWMLGAHHSTEHLV
LVSVFIMGAISLGSAIVSTHRQTIAAFSIPAAVGLISNSLWHGGAVGWVLAFCMTLFLLM
TLKWTFQQADLLEQSLTARFEKEDLARRLAQQVELVESANREKNRFLASASHDLRQPLHA
ISLFTSVLERSPSDPGNAQTIARLSQSVRMLNQSLDTMLDISRLDAGAVQPELAPVRVHE
LFLSLNHMFSGSAEERALQLRFRAPGDLLVVSDVQLLTRLLGNLIDNAIKYTPRGGVLVA
ARTGAAAGRAGWVCFEVIDTGIGIAGEHQQRVFDEFFQLANPQRDRASGLGIGLSIVKRL
SHLLAHPLALTSRPQRGTRFRVWVKEADAQRPGPVDADPVPVTAPTERHLPRHVLVIDDE
PVSREAMALLLTSCGCTVHAAGDLAQAQQLLQRHPIDAVVSDFRLSGERNGLDHLLALRR
SSPQLRTLLVTGETAPQRIADIRASGVPFLHKPVRAQQLLDALAG