Protein Info for PS417_20545 in Pseudomonas simiae WCS417

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details PF00230: MIP" amino acids 3 to 224 (222 residues), 173 bits, see alignment E=4.3e-55 TIGR00861: MIP family channel proteins" amino acids 10 to 224 (215 residues), 196.7 bits, see alignment E=2.3e-62

Best Hits

Swiss-Prot: 76% identical to AQPZ_PSEPK: Aquaporin Z (aqpZ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06188, aquaporin Z (inferred from 94% identity to pfl:PFL_1540)

MetaCyc: 70% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1V230 at UniProt or InterPro

Protein Sequence (233 amino acids)

>PS417_20545 porin (Pseudomonas simiae WCS417)
MSLFKRSITEGLGTFWLVLGGCGSAVLAAAFPAVGIGLLGVSLAFGLTVLTMAFAIGHIS
GCHLNPAVSVGLVVGGRFPARELPAYIVAQVVGGTIAAALLYFIASGKPGFELASGLASN
GYGEHSPGGYSMVAGFVCELVMTAMFVVIILGATDRRAPPGLAPVAIGLALTLIHLISIP
VTNTSVNPARSTGPALIVGGWAIQQLWMFWLAPILGAVIGGVTYRWLGKEEPT