Protein Info for GFF4009 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar biosynthesis protein FliQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 7 to 75 (69 residues), 82.6 bits, see alignment E=8.1e-28 PF04347: FliO" amino acids 19 to 101 (83 residues), 78.2 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 100% identical to FLIO_SALTY: Flagellar protein FliO (fliO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 99% identity to sec:SC1983)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>GFF4009 Flagellar biosynthesis protein FliQ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQVSGALIGIIALILAAAWVIKRMGFAPKGNSVRGLKVSASASLGPRERVVIVEVENARL
VLGVTASQINLLHTLPPAENDTEAPVAPPADFQNMMKSLLKRSGRS