Protein Info for GFF4006 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 254 (240 residues), 266.7 bits, see alignment E=1e-83 PF01311: Bac_export_1" amino acids 15 to 246 (232 residues), 227.5 bits, see alignment E=8.8e-72

Best Hits

Swiss-Prot: 100% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 98% identity to ses:SARI_00956)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF4006 Flagellar biosynthesis protein FliR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPA
NDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHL
NMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIF
LNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFC
EHLFSEIFNLLADIVSEMPINNNP