Protein Info for GFF4002 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative mannosyl-3-phosphoglycerate phosphatase (EC 3.1.3.70)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR02463: mannosyl-3-phosphoglycerate phosphatase homolog" amino acids 9 to 232 (224 residues), 336.4 bits, see alignment E=1.2e-104 TIGR01486: mannosyl-3-phosphoglycerate phosphatase family" amino acids 9 to 267 (259 residues), 303.6 bits, see alignment E=1.6e-94 TIGR01484: HAD hydrolase, family IIB" amino acids 9 to 231 (223 residues), 135.8 bits, see alignment E=3.4e-43 PF08282: Hydrolase_3" amino acids 10 to 232 (223 residues), 47.4 bits, see alignment E=2.2e-16 PF05116: S6PP" amino acids 129 to 267 (139 residues), 26.9 bits, see alignment E=3.5e-10

Best Hits

Swiss-Prot: 100% identical to MPGP_SALTY: Mannosyl-3-phosphoglycerate phosphatase (yedP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07026, mannosyl-3-phosphoglycerate phosphatase [EC: 3.1.3.70] (inferred from 99% identity to sew:SeSA_A2145)

Predicted SEED Role

"Putative mannosyl-3-phosphoglycerate phosphatase (EC 3.1.3.70)" (EC 3.1.3.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF4002 Putative mannosyl-3-phosphoglycerate phosphatase (EC 3.1.3.70) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLSIHDPLLIFTDLDGTLLNSHTFEWQPAAPWLTRLHESGVPVILCSSKTAAEMLQLQTT
LNLQGLPLIAENGAVIQLDVHWEDHPNYPRLIAGISHNEIRLVLHKLREKEQFKFTTFDD
VDDQVISEWTGLNRAQSALTRLHEASVSLIWRDSDERMAQFVARLNDLGLQFVHGARFWH
VLDASAGKDQAANWLIEAYRRQWRARPLTLGLGDGPNDAPLLDVMDYAVVVKGLNREGVH
LRNDDPQRVYRSQNEGPDGWREGMDYFFSRS