Protein Info for GFF4001 in Xanthobacter sp. DMC5

Annotation: Enterobactin exporter EntS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 9 to 35 (27 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 281 to 311 (31 residues), see Phobius details amino acids 359 to 384 (26 residues), see Phobius details PF05977: MFS_3" amino acids 6 to 386 (381 residues), 107.8 bits, see alignment E=5.1e-35 PF07690: MFS_1" amino acids 13 to 347 (335 residues), 101.2 bits, see alignment E=6e-33

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_2137)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>GFF4001 Enterobactin exporter EntS (Xanthobacter sp. DMC5)
MRLRDHPAFVLFWISRVSSALAFQMLGVVVGWLVYSLTGSAAALGLVGLAQFLPILCLTL
LVGHAADTFDRRRIVLACQTLSALTVGALALAERSGHAGLLPIYAAVITIGASRAFEAPT
MAALLPRLVPGEVLPRALAVASSAMQMATIAGPAVGGFAYVFGPAVPLTLAAACYAVAAG
SMAFIRHVHAPGPRSAMTLETLLSGLAFIRRSPVVLGSISLDLFAVLLGGVTALLPIYAG
EILHVGTQGLGALRAAPAMGAVLMSLVLVRRPPTRRVGHIMFAAVAVFGLATVVFALSSS
FLLSLGALFVLGAADNVSVVIRSSLVQLSTPDEMRGRVSAVNSLFVGTSNQLGEFESGMV
AALIGAVGAGVVGGVGTLMVVALWTRLFPALFHVDAMPVKVETRR