Protein Info for GFF3999 in Variovorax sp. SCN45

Annotation: GMP reductase (EC 1.7.1.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR01306: guanosine monophosphate reductase" amino acids 3 to 313 (311 residues), 541.9 bits, see alignment E=3.1e-167 PF00478: IMPDH" amino acids 5 to 309 (305 residues), 208.9 bits, see alignment E=1.1e-65

Best Hits

Swiss-Prot: 95% identical to GUAC_VARPS: GMP reductase (guaC) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00364, GMP reductase [EC: 1.7.1.7] (inferred from 97% identity to vpe:Varpa_1675)

Predicted SEED Role

"GMP reductase (EC 1.7.1.7)" in subsystem Purine conversions (EC 1.7.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF3999 GMP reductase (EC 1.7.1.7) (Variovorax sp. SCN45)
MQIFDYDNILLLPRKCRVESRSECDTSVTLGERSFRLPVVPANMKTVVDESICLWLAQNG
YFYVMHRFDLDNVKFVKDMQGKGVFASISLGVKKPDYDTVDQLVAEGLTPEYITIDIAHG
HADSVKNMIGYLKQKLPKAFVIAGNVGTPEAVIDLENWGADATKVGIGPGKVCITKLKTG
FGTGGWQLSALKWCARVATKPIIADGGIRDHGDIAKSVRFGASMVMIGSLFAGHEESPGK
TVDVDGTLFKEYYGSASDFNKGEYKHVEGKRILEPIKGKLADTLVEMEQDVQSSISYAGG
RTLMDIRKVNYVTLGGDNAGEHLLM