Protein Info for GFF3998 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF00892: EamA" amino acids 13 to 140 (128 residues), 85.1 bits, see alignment E=2.7e-28 amino acids 150 to 284 (135 residues), 65.3 bits, see alignment E=3.7e-22

Best Hits

Swiss-Prot: 90% identical to YEDA_ECOLI: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to spt:SPA0880)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF3998 Permease of the drug/metabolite transporter (DMT) superfamily (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRFRQLLPLFGALFALYIIWGSTYFVIRIGVESWPPLMMAGVRFLSAGMLLMAFLLLRGE
KLPPLRQTINAALIGLLLLAVGNGLVTVAEHQNVPSGIAAVVVATVPLFTLCFSYFFGIK
TRKLEWVGIAIGLAGIILLNSGGNLSGNPWGAILILIGSMSWAFGSVYGSRIALPVGMMA
GAIEMLAAGVVLLCAAFLSGEKLATLPGLSGFMAVGYLALFGSIIAINAYMYLIRNVSPA
LATSYAYVNPVVAVLLGTGLGGERLSPVEWAALGVIVFAVVLVTLGKYLFPVKAVVTPCK
TEDSRQ