Protein Info for GFF3987 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ChlI component of cobalt chelatase involved in B12 biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF20030: bpMoxR" amino acids 20 to 199 (180 residues), 28.8 bits, see alignment E=1.8e-10 PF00158: Sigma54_activat" amino acids 41 to 158 (118 residues), 28.7 bits, see alignment E=3.1e-10 PF07728: AAA_5" amino acids 42 to 172 (131 residues), 48.2 bits, see alignment E=3.5e-16 PF00493: MCM" amino acids 43 to 165 (123 residues), 23.8 bits, see alignment E=6.6e-09 PF01078: Mg_chelatase" amino acids 96 to 159 (64 residues), 30.4 bits, see alignment E=7.9e-11 PF17863: AAA_lid_2" amino acids 238 to 292 (55 residues), 52.9 bits, see alignment 7.7e-18

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 61% identity to bgl:bglu_1g18510)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF3987 ChlI component of cobalt chelatase involved in B12 biosynthesis (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTALPELHAASRAAFPFTALVGHEALQRALLLAAVDPGMGGVLISGPRGTAKSTSARAL
AALLPQAPFVTLPLAASLEQLVGTLNLEDVLRDGLVRLAPGLVARAHGGVLYVDEVNLLP
DALVDALLDVAASGVNTVERDGVSRQHAAQFVLVGTMNPEEGELRPQLLDRFGLSVALAN
PDDAAQRQAIVRARLAFDADPQALLAEHAAAQSRLVATLAAARAALVQLPWSDAVVQHAA
NLALAAGVDGIRADLVMLRAARALAALEQRDSVRVADVDAVAELALAHRRAPDIATPPMS
RPSHAPAGGQGAAAAPNGTAPDGDWGALPPQPEAMVAVKHTGAWPPKKA