Protein Info for GFF3981 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 219 to 245 (27 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details PF01032: FecCD" amino acids 16 to 326 (311 residues), 250.6 bits, see alignment E=9.6e-79

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 78% identity to vpe:Varpa_3375)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF3981 Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSGARHSLWLGSALLIAAVGVLLLGAGVGSTGFDSVLHARHDPVAWQILWDIRLPRTLGA
WVAGGLLGLAGAVAQGLFRNPLADPYLLGSASGAALGVALALALFGTTPFATQWAVRLGL
TGAAFTGAVVGVVLTLALAKGVQHTLRLLLAGVIVGVVLGAARDLVTIASPDTLQAMQGF
MLGSTGFVGWAACGVMAAMGLAALLVAASLGRVLDGLALGEATAISLGLPLVAVRAVLVA
VLALATGAAVAQTGLIAFVGLASPHLVRSIVKTTHGRLIVLSALMGGLLLMAADVLARWI
IAPQELPVGVLTAVLGGSYLLWLMHRRRRPGGGL