Protein Info for GFF3979 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 34 to 335 (302 residues), 265 bits, see alignment E=3.7e-83

Best Hits

Swiss-Prot: 62% identical to Y1770_RHOPA: UPF0324 membrane protein RPA1770 (RPA1770) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: None (inferred from 84% identity to xau:Xaut_2089)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF3979 hypothetical protein (Xanthobacter sp. DMC5)
MTDKHLTDPALIPPAPAVSAAGGPLVTAFGGILPGLAYTVVIAAAAYAIRQVPGMGLVSP
LILAIVIGMALHNIFGTAAIIKPGVKFALRRILRFAIVLLGLQLTFEQVRSVGVVGFSIV
AFTLFATFFVTRWLGRAMGVDRQLSELIAAGTAICGASAVIATNTVTRGSDEDVAYAVAC
VTIFGSLSMLLMPALIPFTGFDAHAFGLWTGASIHEVAQVVAAAFQGGQQAGEFGTVAKL
SRVMLLAPLVIGLGAAAVMRARGDKSAGHASPPMPWFVFGFIAMVMVASSGYVPPEVKMP
VATTTTFLLAVALGAMGLETDMRKLRLKGIKPLLLGAAAWLFISGLSFILIKTLM