Protein Info for GFF3979 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01057005: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07661: MORN_2" amino acids 211 to 228 (18 residues), 15.2 bits, see alignment (E = 1.9e-06) amino acids 259 to 277 (19 residues), 12 bits, see alignment (E = 2.2e-05) amino acids 283 to 304 (22 residues), 15.2 bits, see alignment (E = 1.9e-06) amino acids 307 to 327 (21 residues), 14.4 bits, see alignment (E = 3.7e-06) amino acids 357 to 377 (21 residues), 19.7 bits, see alignment (E = 7.1e-08) amino acids 383 to 399 (17 residues), 10.3 bits, see alignment (E = 7.8e-05) amino acids 404 to 425 (22 residues), 12.2 bits, see alignment (E = 1.9e-05) amino acids 428 to 449 (22 residues), 13.1 bits, see alignment (E = 9.3e-06) amino acids 452 to 473 (22 residues), 10.1 bits, see alignment (E = 8.9e-05) PF08238: Sel1" amino acids 570 to 599 (30 residues), 10.8 bits, see alignment (E = 6.6e-05) amino acids 602 to 634 (33 residues), 15.9 bits, see alignment (E = 1.7e-06) amino acids 636 to 671 (36 residues), 31.4 bits, see alignment (E = 2.1e-11) amino acids 672 to 706 (35 residues), 26.9 bits, see alignment (E = 5.6e-10)

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to seh:SeHA_C2227)

Predicted SEED Role

"FIG01057005: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>GFF3979 FIG01057005: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LKKIFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISSDLKLLLADRYYF
KDKTPCNTNTLSARAESMGLTTEEYINKIRSLRPAILDDRYFYLTVDQCDAGGTPMLTGI
ELCTEALCGAEYMKRSSDLWLDDELQPTVKRQATTVVHMPLPYDKEKKLWKVTGWYLESS
EETGEVMQSKQIAFEGYTNEENFANRQRVSVFKSFYESGNLKSIYHYNAQNKRDGKAETY
FDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQGKIKDGECPHFYDNGVLKQKH
SYLNQKLEGPAFEYFPDGKIKGKYSYSKGTIVGTSTEYYSTGKIRGVYHRNNQGENDGTF
EQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS
KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGAD
RRWSERTGKLVEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKY
IRCYHNDEELSELYAPTDVTNKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHP
GALLFLAYAYNDGDGVAQDSKKYLSYLFKAAELGESDAQLEVGYLNLIGEGMPKNLPEAY
KWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLTAAVKGGVKPALAALKELTPQ
TK