Protein Info for PS417_20305 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF08238: Sel1" amino acids 213 to 247 (35 residues), 35 bits, see alignment 7.6e-13 amino acids 251 to 283 (33 residues), 17.4 bits, see alignment (E = 2.7e-07) amino acids 292 to 321 (30 residues), 19.4 bits, see alignment (E = 6.3e-08) amino acids 365 to 396 (32 residues), 30.3 bits, see alignment (E = 2.3e-11) amino acids 397 to 432 (36 residues), 30.6 bits, see alignment 1.8e-11 amino acids 477 to 504 (28 residues), 17.7 bits, see alignment (E = 2.2e-07)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIZ0 at UniProt or InterPro

Protein Sequence (518 amino acids)

>PS417_20305 hypothetical protein (Pseudomonas simiae WCS417)
MIDKDQFSPFVKALHLHLKHHHPHFNSSLSAVRELVSHALADMPSNGLVNDHLKHSPIPF
GAAAFERLSSAVQQAYGISMPSEFWRWPLPVAFKLSPAERIEIWQAALKHTLSTTEIDGV
WHDGYVDAEPYIKPMGDGRWALCNRSPVPFWLCRDVFTPEWITRRDADNSIADDMAGRQL
KDRSYHAGLSALWKKDYNTAHQRLQEAHEKGHPMASFNLGWMYSEGLGRDRDFTKAAELY
ERAADLGVLTAHHNLGRMHLEGDEHFPKSIPDAIRHFELAAEGDIAASIGCLGMIYLNGN
GVPEDRDRAIDLLMRAAYLDDDHSINTVATILDHQNGGASTPESFALYRKAARSARQLNH
IMPIYNLGLCFLHGNGVGKNLVKARRLFRIAANAGDADAAMNLGLMFLNGEGIPADSIEA
RHWLTMSAAHGSGDAFNVLGTIEFNGQCGAPNHRLAWLLFSEAAQMGSVIGLANQARCLV
TGQGVEQDVELACELLEQAEAQGHPMAREMRIQWESQV