Protein Info for GFF3963 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Additional substrate-specific component CbiN of cobalt ECF transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details TIGR01165: cobalt transport protein" amino acids 1 to 85 (85 residues), 135.5 bits, see alignment E=3e-44 PF02553: CbiN" amino acids 5 to 69 (65 residues), 102 bits, see alignment E=7e-34

Best Hits

Swiss-Prot: 100% identical to CBIN_SALEP: Cobalt transport protein CbiN (cbiN) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K02009, cobalt transport protein (inferred from 98% identity to spq:SPAB_01083)

Predicted SEED Role

"Additional substrate-specific component CbiN of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (93 amino acids)

>GFF3963 Additional substrate-specific component CbiN of cobalt ECF transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQAIAPQYKPWFQPLYEPASGEI
ESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA