Protein Info for GFF3961 in Pseudomonas sp. DMC3

Annotation: Aerobic C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details amino acids 308 to 339 (32 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details PF00375: SDF" amino acids 10 to 402 (393 residues), 340.2 bits, see alignment E=8.6e-106

Best Hits

Swiss-Prot: 77% identical to DCTA1_PSEA7: C4-dicarboxylate transport protein 1 (dctA1) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 98% identity to pfo:Pfl01_4878)

Predicted SEED Role

"probable dicarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF3961 Aerobic C4-dicarboxylate transport protein (Pseudomonas sp. DMC3)
MLRWCSRSIFLQVVLGLMLGIVCGLTLPEYSAQLKPLGDGFIKLIKMLIGLIVFCVVVSG
ISGAGDLKKVGRIGLKSVIYFEVLTTIALVIGLVFAFSTGIGSGANIHLEQLSSADMGDL
AERSQHMHTTTQFLMDLIPTSVIGAFADNNILQVLLFSVLFGSALNLVGEAASGISRLIN
ELSHVIFRIMGMIVRLAPIGVFGAIAFTTSKYGLDSLQHLGSLVGLFYLTCVAFVALILG
LVMRVSGLRMWPLLKYLREELLIVMGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYS
FNLDGFSIYLTLAIVFIANATGTPLAMTDLLTILLVSLITSKGAHGIPGSALVILAATLT
AIPAIPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDIDIQRANKVLNGEQG
YNFQPRKTVAPAAAKEF