Protein Info for GFF3960 in Xanthobacter sp. DMC5

Annotation: Carboxy-terminal processing protease CtpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF22694: CtpB_N-like" amino acids 34 to 88 (55 residues), 43.3 bits, see alignment 1e-14 TIGR00225: C-terminal processing peptidase" amino acids 54 to 372 (319 residues), 349.6 bits, see alignment E=8.4e-109 PF00595: PDZ" amino acids 100 to 170 (71 residues), 30.2 bits, see alignment E=1.2e-10 PF13180: PDZ_2" amino acids 102 to 182 (81 residues), 49 bits, see alignment E=1.6e-16 PF17820: PDZ_6" amino acids 117 to 171 (55 residues), 36.3 bits, see alignment 9.2e-13 PF03572: Peptidase_S41" amino acids 200 to 367 (168 residues), 199.6 bits, see alignment E=6.6e-63

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 94% identity to xau:Xaut_2072)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF3960 Carboxy-terminal processing protease CtpA (Xanthobacter sp. DMC5)
MRRTSLFLFGVAAGALVAVAAVQPRLILGTAAEAASSDTYKQLNLFGDVFERVRSDYVEK
PDDAKLIEAAINGMLQSLDPHSSYMDAKNHRDMQVQTRGEFGGLGIEVIMEDGLVKVVTP
MEDTPAAKAGVLSGDLIAKLDGDQVQGMTLNEAVDKMRGAVNTPITLTILRKGVEKPIEV
KLVRDTIKLQTVRSRIEADDIAYIRINSFTNEQTFETLKKAIDDLTAKIGPDKIKGYIID
LRNNPGGLLDQAVAVSDAFLERGEIVSTRGRNPEETQRFNARGGDLTKGKPVIVMVNGGS
ASASEIVAGALQDHKRATILGSRTFGKASVQTIIPLGQQGALRLTTARYYTPSGRSIQAK
GIEPDIVLVQDLPDEMKQKLGVSTDSTRGEASLKGHLKNGDDEQTGSPSYVPPDPKDDTQ
LKLAVELMKGTVKNAAFPATPNKSSQAN