Protein Info for GFF396 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 62 to 80 (19 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details TIGR02946: acyltransferase, WS/DGAT/MGAT" amino acids 46 to 511 (466 residues), 344.3 bits, see alignment E=5.9e-107 PF03007: WS_DGAT_cat" amino acids 46 to 324 (279 residues), 98.6 bits, see alignment E=5.5e-32 PF06974: WS_DGAT_C" amino acids 367 to 508 (142 residues), 130.5 bits, see alignment E=5.1e-42

Best Hits

KEGG orthology group: None (inferred from 66% identity to rfr:Rfer_3531)

Predicted SEED Role

"Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>GFF396 Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVQRVAARPGPSAARPAKSPAALVRGASASVQHALATTLGLEGERMSKVDTAWLRMDSPS
NLMMIVGVWILRPGVTPAALKERVRERLLPYPRFVQIAREDAAGAHWTHDPDFQIDRHIV
THQLKRRRGQTEQDALQDRVGELAMQPLDHGHPLWRFELIERYDGGSALIARIHHCIADG
IALISVMMSLVDGGGAPPERQRRKASKNRLDGAEDWLADTLIRPFGDITAKALEVAGGGA
AKSLSMLAAPQQSLSDTLGQAVDIARMGGQLASDLASLALMPDDSPTRLKGQPGQTKRVA
WCEPIPLDEVKAIGKAMNCSVNDVLLGCVAGAIGAYLRGLGDDTAGKEIRAMVPINLRPL
EEAWKLGNRFGLVPLVLPIGLDNPIERVFAVRSRMNELKGSLQPLLTFGLLSVAGLLIKP
AQDAMLSLFGRKTTAVMTNVPGPATKLKVCGSTLEQTMFWVPQTGTVGLGVSILSYGGGV
QFGVIADTRLCPDPQQIIDRFEPEFARLLTLTLMLPWGEAKG