Protein Info for GFF396 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Possible divergent polysaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04748: Polysacc_deac_2" amino acids 28 to 237 (210 residues), 262.2 bits, see alignment E=1.3e-82

Best Hits

Swiss-Prot: 80% identical to YIBQ_ECOLI: Uncharacterized protein YibQ (yibQ) from Escherichia coli (strain K12)

KEGG orthology group: K09798, hypothetical protein (inferred from 98% identity to sty:STY4089)

Predicted SEED Role

"Possible divergent polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF396 Possible divergent polysaccharide deacetylase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LPQFRRSILTLATLLAFAHPVFAGKLAIVIDDFGYRPHTENQVLALPPNISVAVLPNAPH
AREMATKAHNSGHEVLIHLPMAPLSKQPLEKDTLRPDMSSDEIERIIREAVNNVPYAVGL
NNHMGSAMTSSLFGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDD
TQNEADIRRQFNRAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPADITLVRPGSLLNE
PQVDTSRPGVTPQKIDAPRNPFRGVKMCKPKKPLQPVYATRFFSVIGESITQSSVVTWFQ
HQWQGWGKIAAPKNVSAKTD