Protein Info for PS417_20255 in Pseudomonas simiae WCS417

Annotation: copper resistance protein CopB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05275: CopB" amino acids 67 to 271 (205 residues), 300.2 bits, see alignment E=3.7e-94

Best Hits

Swiss-Prot: 67% identical to COPB_PSESM: Copper resistance protein B homolog (copB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K07233, copper resistance protein B (inferred from 74% identity to pba:PSEBR_a4427)

Predicted SEED Role

"Copper resistance protein B" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPQ4 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PS417_20255 copper resistance protein CopB (Pseudomonas simiae WCS417)
MSRRISPVLLALAFAPLAQADEFQGMSPATPALTESRTPIPVLTDADRAAVYNAPGGHRV
HDHGINSLLLINQLEWQGGEGDGALNWDIKGWVGGDIDRLWLRSEGERSAGRTESAEAQA
LWGHAISPWWDVVGGVRQDFKPGDGQTWAAFGAQGMALYNFEAEATVFVGESGRTAARLE
GDYDFLLTNRLILQPTAELNFYGRNDPQRGVGSGLSDSELGLRLRYEVRREFAPYVGVTW
HRSYGQTAQYARDDGEDTNQVRWVVGMRLWF