Protein Info for GFF3955 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit" amino acids 13 to 132 (120 residues), 142 bits, see alignment E=5.5e-46 PF05175: MTS" amino acids 22 to 141 (120 residues), 34.5 bits, see alignment E=3.9e-12 PF06325: PrmA" amino acids 25 to 142 (118 residues), 29 bits, see alignment E=1.9e-10 PF13847: Methyltransf_31" amino acids 30 to 84 (55 residues), 27.1 bits, see alignment E=8.3e-10 PF08242: Methyltransf_12" amino acids 36 to 127 (92 residues), 30.5 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 100% identical to CBIT_SALTY: Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) (cbiT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02191, precorrin-8W decarboxylase [EC: 1.-.-.-] (inferred from 100% identity to seh:SeHA_C2252)

MetaCyc: 100% identical to cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating] monomer (Salmonella enterica enterica serovar Typhimurium)
RXN-8766 [EC: 2.1.1.196]

Predicted SEED Role

"Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>GFF3955 Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKDELFLRGENVPMTKEAVRALALSKLELHRASHLIDVGAGTGSVSIEAALQFPSLQVTA
IERNPAALRLLDENRQRFACGNIDILPGEAPMTITGKADAVFMGGSGGHLTALIDWAMGH
LHPGGRLVMTFILQENLHSALAHLAHIGACRMDCVQLQLSSLTPLGAGHYFKPNNPVFVI
ACQKEENHVRDI