Protein Info for GFF3954 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF10073: GapR_DNA-bd" amino acids 35 to 106 (72 residues), 117.8 bits, see alignment E=6.3e-39

Best Hits

Swiss-Prot: 64% identical to Y1188_BRASO: UPF0335 protein BRADO1188 (BRADO1188) from Bradyrhizobium sp. (strain ORS 278)

KEGG orthology group: None (inferred from 64% identity to bra:BRADO1188)

Predicted SEED Role

"FIG00451076: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF3954 hypothetical protein (Xanthobacter sp. DMC5)
LTRAPARHGLDGRAAEPKETVQVAEDVSDSPAGFAKEQLKSFIERIERLEEEKKAIADDI
KDVFAEAKANGFDVKALRTILKIRKEDVDERKEHEAIVDLYMQALGIFV