Protein Info for GFF3954 in Variovorax sp. SCN45

Annotation: Similar to cobalamin biosynthesis protein CbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF03186: CobD_Cbib" amino acids 25 to 265 (241 residues), 89.9 bits, see alignment E=1.8e-29 PF17113: AmpE" amino acids 64 to 235 (172 residues), 24.3 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 93% identity to vpe:Varpa_1634)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF3954 Similar to cobalamin biosynthesis protein CbiB (Variovorax sp. SCN45)
MSFFAILCALLIEQVRPLGPHNPVYGSVLAWTRWTSRNFDAGKPHHGWIAWGLAVFVPTL
LALGVHWLLVLTLGLPFAVLWSIAVLYVTLGFRQFSHHFTDIRDALDEGDEPLARSLLAH
WQGVDAADLPRSEIVRHVIEHSVIAAHRHVFGVLAWFSIIAAIGLGPAGAVFYRMSEFVS
RYWAHKNGAAVQPSSVSVQEAADRAWHAVDWLPARITALGFAVVGSFEEAIDCWRNDAQR
FPNENDGVILAATSGAVNVRLGGGSLRPIPTLDPLSRAQAGDSIADGRAPDSGSTPGREP
EPAHLRSVVGLVWRSVVMWMVLLALLTLARLLG