Protein Info for PS417_20245 in Pseudomonas simiae WCS417

Annotation: copper resistance protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF05425: CopD" amino acids 172 to 278 (107 residues), 74.9 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 48% identical to COPD_PSESF: Copper resistance protein D (copD) from Pseudomonas syringae pv. actinidiae

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 51% identity to pba:PSEBR_a4429)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4L5 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PS417_20245 copper resistance protein CopD (Pseudomonas simiae WCS417)
MSELVAVLLRFALYLDLMLVFGLGLFGLYADSRLLNLKPLMRRLVGLGVLLSLASLLSMT
QAMSGAEDWPTLWMHLQMMLWQTELGWTWWSRIAALVLVVLSTRLATLFGGVALVTLAWA
GHGVMHEGSLGGWHLLSDSAHLLAAAGWVGALAAFGLMLASASEQAVPVLAHALTGFERV
GVVFVAVLMGTGVANYLFVVGPNLDGITGGVYAILLCLKLGAFGLMLGLAALNRSHLTPL
LQRSLAAGDHRAARQALRRSITLEFGAAVLILGLVAWLGTLAPR