Protein Info for GFF3948 in Variovorax sp. SCN45

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 3 to 140 (138 residues), 38.2 bits, E=4.6e-13
• PF13420: Acetyltransf_4
  • amino acids 5 to 159 (155 residues), 56.4 bits, E=7.6e-19
• PF00583: Acetyltransf_1
  • amino acids 35 to 139 (105 residues), 60.4 bits, E=4e-20
• PF13508: Acetyltransf_7
  • amino acids 55 to 124 (70 residues), 37.2 bits, E=6.5e-13

Best Hits

Swiss-Prot: 52% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 91% identity to vpe:Varpa_1628)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase"

MetaCyc Pathways

• phosalacine biosynthesis (4/25 steps found)
• phosphinothricin tripeptide biosynthesis (4/25 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Protein Sequence (174 amino acids)

>GFF3948 Acetyltransferase, GNAT family (Variovorax sp. SCN45)
MPLTIRPSRDEDIAAITAIYAHHVLHGTGTFETEPPSPADMASRRADVLGKNLPYLVAEE
NGEVLGFAYCNWFKPRPAYRFSAEDSIYMSESARGKGLGAKLLAALSQAAEAAGVRKLIA
VIGDSANAGSIGVHRGQGFTHVGVLKDCGWKFGEWRDVVLMEKVLGEGSTTRPE