Protein Info for GFF3948 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propanediol diffusion facilitator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PDUF_SALTY: Propanediol diffusion facilitator (pduF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to stt:t0837)

MetaCyc: 69% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Propanediol diffusion facilitator" in subsystem Propanediol utilization

MetaCyc Pathways

glycerol and glycerophosphodiester degradation (4/4 steps found)
glycerol degradation I (3/3 steps found)
arsenate detoxification III (2/2 steps found)
arsenic detoxification (plants) (4/6 steps found)
arsenic detoxification (mammals) (8/17 steps found)
arsenic detoxification (yeast) (4/12 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF3948 Propanediol diffusion facilitator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNDSLKAQCGAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTAGI
SGGHLNPAVTIALWLFACFPKQKVLPYIIAQFAGAFGGALLAYVLYSSLFTEFETAHHMV
RGSVESLQLASIFSTYPAAALNVWQAALVEVVITSILMGMIMALTDDGNGIPKGPLAPLL
IGILVAVIGASTGPLTGFAMNPARDFGPKLFTWLAGWGNMAMSGGREIPYFIVPIVAPVI
GACAGAAIYRYFIGKNLPCNRCEL